PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 29767.m000208
Common NameLOC8260247, RCOM_0761820
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Acalyphoideae; Acalypheae; Ricinus
Family WRKY
Protein Properties Length: 296aa    MW: 32892.6 Da    PI: 5.5902
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
29767.m000208genomeJCVIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY102.42.6e-32117173258
                    --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS CS
           WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnh 58 
                    dDgy+WrKYGqK++k+s+fprsYYrCt ++C++kk+vers+ed+++++itYeg H h
  29767.m000208 117 DDGYKWRKYGQKSIKNSPFPRSYYRCTNPRCSAKKQVERSSEDQDTLVITYEGLHLH 173
                    8******************************************************99 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5081126.808111176IPR003657WRKY domain
Gene3DG3DSA:2.20.25.801.8E-29112173IPR003657WRKY domain
SuperFamilySSF1182901.07E-26113173IPR003657WRKY domain
SMARTSM007749.1E-36116175IPR003657WRKY domain
PfamPF031061.1E-25117173IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 296 aa     Download sequence    Send to blast
MEEVKENWVI NGSEDELIVR ELLDDESPFF LLPNELPLQS KLTSPDDHTN RLISTVYSGP  60
TIHDIENALS FTASHKDHSQ AISQARISIL EKGLGLSKTD NNKYTLKLKT CGNGMADDGY  120
KWRKYGQKSI KNSPFPRSYY RCTNPRCSAK KQVERSSEDQ DTLVITYEGL HLHFAYPYFL  180
VDQANHLKPP LKKPKKSTSK AEETQQTQED EAQECPSQEA SATLTSSLDD CPQGSGGPQG  240
LLEDVVPFMI RNPSNTNNIA SSMSSCSPPT SPSSLSWSPI QSHSCFDFGI STSISH
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2ayd_A2e-221151731371WRKY transcription factor 1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002530990.10.0PREDICTED: probable WRKY transcription factor 49
TrEMBLB9SYC10.0B9SYC1_RICCO; WRKY transcription factor, putative
STRINGPOPTR_0006s08730.11e-100(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF71183449
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G43290.18e-52WRKY DNA-binding protein 49